PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_126.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Nin-like
Protein Properties Length: 372aa    MW: 41557.6 Da    PI: 5.2701
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_126.43genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.82.9e-25280330252
                        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                   + +++++d+  yF+lpi++AAk++++c+Tv+KriCR+ G++RWPhRkiks+
  evm.model.supercontig_126.43 280 TGKLTIKDVGPYFHLPIEEAAKKMNLCPTVMKRICRRAGLSRWPHRKIKSI 330
                                   56899********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803270350IPR003035RWP-RK domain
PfamPF020423.2E-22283330IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MADPAATVPY HDPYDVPFED EILDFIGDPN PTLFDLSMTT QEEGAVLPFS NPSSVLNPSN  60
QIADSDNLLD DPVMWEFYGK PDMAGSSQAG SSRNYGGETS NERREENWQL QNMTLDYGNN  120
NHSQILSNWP PSPLPFGCSC CQVLREIIHS NGRDVTKLEI HGRLGLICHA ILDIHSSASV  180
SQNHHYEMWD FCKKSIADVK QLLVQYCFER NQEGFWMVQD PLSLFYEALC VGFAWDENLN  240
RGEFVPPSSN AAGAETSQPK TDNNSPSAPK TSLAAQRERT GKLTIKDVGP YFHLPIEEAA  300
KKMNLCPTVM KRICRRAGLS RWPHRKIKSI ERKISDCTPD LNSNNAELRA RAQADIEKLQ  360
KQIDKIRAGG A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474671.11e-119PREDICTED: uncharacterized protein LOC102621663
TrEMBLF8WLA71e-119F8WLA7_CITUN; Putative uncharacterized protein ORF40
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342
Representative plantOGRP1033348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-12RWP-RK domain-containing protein